001f recombinant proteins fus egfp wang et Search Results


99
Expression Systems Inc sf9 cells recombinant bacmid dna
Sf9 Cells Recombinant Bacmid Dna, supplied by Expression Systems Inc, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm14993906-46-7-24?v=Expression+Systems+Inc
Average 99 stars, based on 1 article reviews
sf9 cells recombinant bacmid dna - by Bioz Stars, 2026-07
99/100 stars
  Buy from Supplier

95
ATCC scrc 1010 hek293t atcc crl 3216 sf9 cells expression systems 94 001f oligonucleotides oligoa bsmbi side1 biotin
Scrc 1010 Hek293t Atcc Crl 3216 Sf9 Cells Expression Systems 94 001f Oligonucleotides Oligoa Bsmbi Side1 Biotin, supplied by ATCC, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm38521066-260-113-115?v=ATCC
Average 95 stars, based on 1 article reviews
scrc 1010 hek293t atcc crl 3216 sf9 cells expression systems 94 001f oligonucleotides oligoa bsmbi side1 biotin - by Bioz Stars, 2026-07
95/100 stars
  Buy from Supplier

94
ATCC hek293t atcc recombinant dna pfastbac bril mas1
Hek293t Atcc Recombinant Dna Pfastbac Bril Mas1, supplied by ATCC, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm41912627-176-35-36?v=ATCC
Average 94 stars, based on 1 article reviews
hek293t atcc recombinant dna pfastbac bril mas1 - by Bioz Stars, 2026-07
94/100 stars
  Buy from Supplier

94
Alomone Labs rabbit igg isotype control-fitc
Rabbit Igg Isotype Control Fitc, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/custom%40ric-001-f%40pmc12333952__jciinsight-10-187967-s033?v=Alomone+Labs
Average 94 stars, based on 1 article reviews
rabbit igg isotype control-fitc - by Bioz Stars, 2026-07
94/100 stars
  Buy from Supplier

ige  (Bio-Rad)
94
Bio-Rad ige
Ige, supplied by Bio-Rad, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pmc09902533__41467_2023_35792_MOESM2_ESM-43-0-1?v=Bio-Rad
Average 94 stars, based on 1 article reviews
ige - by Bioz Stars, 2026-07
94/100 stars
  Buy from Supplier

90
GenScript corporation fitc-ahx-qistpsdfmhivhmgpapvmelqqnfidlq
Fitc Ahx Qistpsdfmhivhmgpapvmelqqnfidlq, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm36854301-162-19-22?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
fitc-ahx-qistpsdfmhivhmgpapvmelqqnfidlq - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

90
AllCells LLC h-001f-c
H 001f C, supplied by AllCells LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm32142647-234-213-211?v=AllCells+LLC
Average 90 stars, based on 1 article reviews
h-001f-c - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

90
Promega streptavidin paramagnetic particles
Streptavidin Paramagnetic Particles, supplied by Promega, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/10__7554_slash_elife__96743-256-53-50?v=Promega
Average 90 stars, based on 1 article reviews
streptavidin paramagnetic particles - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

90
Schrodinger LLC pymol
Pymol, supplied by Schrodinger LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm30503777-224-234-235?v=Schrodinger+LLC
Average 90 stars, based on 1 article reviews
pymol - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

93
Addgene inc n a recombinant dna pbig1a vector weissmann
N A Recombinant Dna Pbig1a Vector Weissmann, supplied by Addgene inc, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm38521066-260-204-212?v=Addgene+inc
Average 93 stars, based on 1 article reviews
n a recombinant dna pbig1a vector weissmann - by Bioz Stars, 2026-07
93/100 stars
  Buy from Supplier

90
GraphPad Software Inc prism 9
Prism 9, supplied by GraphPad Software Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/10__7554_slash_elife__96743-256-202-205?v=GraphPad+Software+Inc
Average 90 stars, based on 1 article reviews
prism 9 - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

90
GenScript corporation arginine vasopressin peptide (avp)
Arginine Vasopressin Peptide (Avp), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm34582793-216-47-59?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
arginine vasopressin peptide (avp) - by Bioz Stars, 2026-07
90/100 stars
  Buy from Supplier

Image Search Results