99
|
Expression Systems Inc
sf9 cells recombinant bacmid dna Sf9 Cells Recombinant Bacmid Dna, supplied by Expression Systems Inc, used in various techniques. Bioz Stars score: 99/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm14993906-46-7-24?v=Expression+Systems+Inc Average 99 stars, based on 1 article reviews
sf9 cells recombinant bacmid dna - by Bioz Stars,
2026-07
99/100 stars
|
Buy from Supplier |
95
|
ATCC
scrc 1010 hek293t atcc crl 3216 sf9 cells expression systems 94 001f oligonucleotides oligoa bsmbi side1 biotin Scrc 1010 Hek293t Atcc Crl 3216 Sf9 Cells Expression Systems 94 001f Oligonucleotides Oligoa Bsmbi Side1 Biotin, supplied by ATCC, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm38521066-260-113-115?v=ATCC Average 95 stars, based on 1 article reviews
scrc 1010 hek293t atcc crl 3216 sf9 cells expression systems 94 001f oligonucleotides oligoa bsmbi side1 biotin - by Bioz Stars,
2026-07
95/100 stars
|
Buy from Supplier |
94
|
ATCC
hek293t atcc recombinant dna pfastbac bril mas1 Hek293t Atcc Recombinant Dna Pfastbac Bril Mas1, supplied by ATCC, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm41912627-176-35-36?v=ATCC Average 94 stars, based on 1 article reviews
hek293t atcc recombinant dna pfastbac bril mas1 - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
94
|
Alomone Labs
rabbit igg isotype control-fitc Rabbit Igg Isotype Control Fitc, supplied by Alomone Labs, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/custom%40ric-001-f%40pmc12333952__jciinsight-10-187967-s033?v=Alomone+Labs Average 94 stars, based on 1 article reviews
rabbit igg isotype control-fitc - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
94
|
Bio-Rad
ige Ige, supplied by Bio-Rad, used in various techniques. Bioz Stars score: 94/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pmc09902533__41467_2023_35792_MOESM2_ESM-43-0-1?v=Bio-Rad Average 94 stars, based on 1 article reviews
ige - by Bioz Stars,
2026-07
94/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
fitc-ahx-qistpsdfmhivhmgpapvmelqqnfidlq Fitc Ahx Qistpsdfmhivhmgpapvmelqqnfidlq, supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm36854301-162-19-22?v=GenScript+corporation Average 90 stars, based on 1 article reviews
fitc-ahx-qistpsdfmhivhmgpapvmelqqnfidlq - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |
90
|
AllCells LLC
h-001f-c H 001f C, supplied by AllCells LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm32142647-234-213-211?v=AllCells+LLC Average 90 stars, based on 1 article reviews
h-001f-c - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |
90
|
Promega
streptavidin paramagnetic particles Streptavidin Paramagnetic Particles, supplied by Promega, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/10__7554_slash_elife__96743-256-53-50?v=Promega Average 90 stars, based on 1 article reviews
streptavidin paramagnetic particles - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |
90
|
Schrodinger LLC
pymol Pymol, supplied by Schrodinger LLC, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm30503777-224-234-235?v=Schrodinger+LLC Average 90 stars, based on 1 article reviews
pymol - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |
93
|
Addgene inc
n a recombinant dna pbig1a vector weissmann N A Recombinant Dna Pbig1a Vector Weissmann, supplied by Addgene inc, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm38521066-260-204-212?v=Addgene+inc Average 93 stars, based on 1 article reviews
n a recombinant dna pbig1a vector weissmann - by Bioz Stars,
2026-07
93/100 stars
|
Buy from Supplier |
90
|
GraphPad Software Inc
prism 9 Prism 9, supplied by GraphPad Software Inc, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/10__7554_slash_elife__96743-256-202-205?v=GraphPad+Software+Inc Average 90 stars, based on 1 article reviews
prism 9 - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |
90
|
GenScript corporation
arginine vasopressin peptide (avp) Arginine Vasopressin Peptide (Avp), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/001f+recombinant+proteins+fus+egfp+wang+et/pm34582793-216-47-59?v=GenScript+corporation Average 90 stars, based on 1 article reviews
arginine vasopressin peptide (avp) - by Bioz Stars,
2026-07
90/100 stars
|
Buy from Supplier |